
VIP
Vasoactive Intestinal Peptide, a 28-amino-acid neuropeptide with broad functions spanning vasodilation, immune modulation, neuroprotection, and circadian rhythm regulation. All presented information is based on scientific publications which can be found at the end of product description below.
Product Specifications
Descriere
Toate informațiile prezentate se bazează pe publicații științifice, care pot fi consultate la sfârșitul descrierii produsului, mai jos.
VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide signaling through VPAC1 and VPAC2 receptors, mediating diverse physiological functions across the nervous, immune, and gastrointestinal systems.
Research Highlights
1. Immune Modulation — Inhibits pro-inflammatory cytokines (TNF-α, IL-6, IL-12) while promoting IL-10.
2. Neuroprotection — Promotes neuronal survival against oxidative stress, excitotoxicity, and amyloid-beta toxicity.
3. Pulmonary Function — Bronchodilator and pulmonary pressure regulator. Investigated for pulmonary arterial hypertension.
4. GI Regulation — Relaxes smooth muscle, stimulates secretion, modulates intestinal motility.
5. Circadian Rhythm — VIP-expressing SCN neurons essential for circadian rhythmicity.
6. Reproductive Biology — Influences steroidogenesis, uterine contractility, and erectile function.
References available upon request.
The product is intended for scientific research and development purposes only. Chemical substances shall not be used as a drug, medicine, active substance, medical aid, cosmetic product, a substance for production of a cosmetic product neither for human consumption that is any food or food supplement or otherwise similarly used on humans or animals. Intended only for in-vitro research, such as Receptor-ligand binding studies, Enzyme activity assays, Cell proliferation assays, Cell signaling assays, Epitope mapping, etc.
Doar pentru uz de cercetare: Produsul este destinat exclusiv scopurilor de cercetare științifică și dezvoltare. Substanțele chimice nu trebuie utilizate ca medicament, substanță activă, ajutor medical, produs cosmetic, substanță pentru producerea unui produs cosmetic și nici pentru consum uman ca aliment sau supliment alimentar și nici utilizate în alt mod similar pe oameni sau animale. Destinat exclusiv pentru cercetare in-vitro, precum studii de legare receptor-ligand, teste de activitate enzimatică, teste de proliferare celulară, teste de semnalizare celulară, mapare a epitopilor etc.
🇪🇺 Livrare UE & UK • Gratuită peste 300€ • 2-5 zile lucrătoare
Întrebări frecvente
- VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide with sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2. Molecular weight is approximately 3326 Da. It is a member of the secretin/glucagon family of peptides.
- Each batch is HPLC-MS verified at ≥99% purity. COA included with every shipment, listing identity confirmation, lot, and synthesis date.
- Store lyophilised at -20 °C in a sealed vial protected from light and moisture. Reconstituted solutions are relatively unstable — aliquot for single use and avoid repeated freeze-thaw cycles.
- VIP has been studied in models of neural protection, gastrointestinal motility, vasodilation, and immune modulation. It is also investigated as a tool peptide in receptor pharmacology (VPAC1/VPAC2 receptors).
- VIP is a naturally occurring peptide investigated in various research contexts. The synthetic form supplied by Peptra Labs is strictly for laboratory research and is not approved for human or veterinary use.










